trOfp
ghostbusters proton pack toydrip ringpolice baton123d makedire batbrass lancashireenglish bulldog freepopper fishing lureapc40drill sanderpill storageniftycasemakeshapermilitarystocking holdersparkplug fortniteanycubic predator large spoolboite rangement vispilgrimpp700yoga mat holderue mini boompicatinny rail extensiongopro lite mountsimple bookends

popular models by Marius Mihasan —

Most downloadable free 3D models by Marius Mihasan
A betasheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
An alpha helix from Hemoglobin as cartoon
Marius Mihasan
An alpha helix from Hemoglobin as cartoon
Main components a bovine mitochondrial ATP synthase
Marius Mihasan
Main components a bovine mitochondrial ATP synthase
T7 DNA replisome
Marius Mihasan
T7 DNA replisome
A set of protein domains reading DNA sequence  TAL effector Zn finger ECO RI Endonuclease
Marius Mihasan
A set of protein domains reading DNA sequence - TAL effector, Zn finger, ECO RI Endonuclease
An alpha helix from Hemoglobin as balls and sticks
Marius Mihasan
An alpha helix from Hemoglobin as balls and sticks
BDNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
An alpha helix from Hemoglobin as cartoon with the sidechains visible
Marius Mihasan
An alpha helix from Hemoglobin as cartoon with the sidechains visible
A betasheet from a sucrose specific porin as cartoon with the sidechains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Microplate adapter for GFL shakers
Marius Mihasan
Microplate adapter for GFL shakers
T7 RNA polymerase model
Marius Mihasan
T7 RNA polymerase model
Vortex Genie 2 Attachments for bead beating
Marius Mihasan
Vortex Genie 2 Attachments for bead beating
An alpha helix from Hemoglobin as surface
Marius Mihasan
An alpha helix from Hemoglobin as surface
BDNA dodecamer as balls and sticks
Marius Mihasan
B-DNA dodecamer as balls and sticks
A betasheet from a sucrose specific porin  peptide backbone as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
Bolt and nut for repairing an Acerbis Koerta body armorprotector jacket
Marius Mihasan
Bolt and nut for repairing an Acerbis Koerta body armor/protector jacket
BDNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
tRNA in various representations
Marius Mihasan
tRNA in various representations
Next page  
2025 — TROFP — Privacy Policy