pcp stock
cute cthulhu
optiplex 580
buckaroo banzai
ski wax scraper sharpener
pizza planet truck
cartridge holder
hexagon pattern
spacex falcon 9
htc evo 3d
estadio de boca bombonera
rifle wall mount
mic stand holder
heely wheel hold 1
harbor freight gloves
canon viewfinder cover
guyver helmet
chevy trailer hitch cover
holocom
28mm hoplite
mannequin drawing
corn butter
anbu mask
wolf head ring
hobby holder
Free
Printables
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta sheet from a sucrose specific porin as cartoon alternatives
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
An alpha helix from Hemoglobin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
NZ2000
Spirit Geolink bracket
popejpii
The Holy Hand Grenade
Woodmore
1949 Chevy Duplo
Jude
Apple Watch Dock
gillis
YoYo (JoJo)
Find more