sunny bunniesimperial jade sealsmile maskaccu chek combodeer headmaster roshi turtlekraken tentaclehalf venom maskaquarium tubingadventmillimeter rulerironman ringcool turtlemini air pumphc sr04 sonar mount dronediaper genieares amoeba stockbreakout type srotating display standgraveyardever after highwu tang clan logoultimate mjolnirlaptop lcd controller boarddyson v7
A beta sheet from a sucrose specific porin as cartoon
Free     Printables     Marius Mihasan

A beta sheet from a sucrose specific porin as cartoon

A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
—   Go to Printables  

similar models —

A beta sheet from a sucrose specific porin as cartoon alternatives
A betasheet from a sucrose specific porin as cartoon with the sidechains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
A betasheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
An alpha helix from Hemoglobin as cartoon
Marius Mihasan
An alpha helix from Hemoglobin as cartoon
A betasheet from a sucrose specific porin peptide backbone as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
Spirit Geolink bracket
NZ2000
Spirit Geolink bracket
The Holy Hand Grenade
popejpii
The Holy Hand Grenade
1949 Chevy Duplo
Woodmore
1949 Chevy Duplo
Apple Watch Dock
Jude
Apple Watch Dock
YoYo JoJo
gillis
YoYo (JoJo)
2026 — TROFP — Privacy Policy