infinity stones iron mandiy grindersponge holderscx10 wheel wellsland rover rc bodysmallrig cagemgn12h adaptermouse jigglercool lightsaberluke skywalker a new hopeshaving razorwmr gun stockwatchmen rorschachscorpiondaenerys targaryen chainsilent hill gamewavebird1d logocoasters holderpalace of versaillesinductrix canopyhand splintcat bookendscreamerdionysus
A beta sheet from a sucrose specific porin as surface
Free     Printables     Marius Mihasan

A beta sheet from a sucrose specific porin as surface

A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
—   Go to Printables  

similar models —

A beta sheet from a sucrose specific porin as surface alternatives
A betasheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
A betasheet from a sucrose specific porin as cartoon with the sidechains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
An alpha helix from Hemoglobin as surface
Marius Mihasan
An alpha helix from Hemoglobin as surface
BDNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
BDNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
A betasheet from a sucrose specific porin peptide backbone as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
Spirit Geolink bracket
NZ2000
Spirit Geolink bracket
The Holy Hand Grenade
popejpii
The Holy Hand Grenade
1949 Chevy Duplo
Woodmore
1949 Chevy Duplo
2026 — TROFP — Privacy Policy