rabbit alice in wonderlandzombicide season 2kylo ren miniatureoutboard hose flushstorm32 gimbalpongflintlock rifleellie borderlandstablet endervacuum attachmentsbitcoin logodanish heartcinderella glass slipperdremel digilabeepromservo ball valvesd card caseairsoft upgradessupernatural angel swordelvgameboy battery coverspell tokennoaa antennagun accessoriesspace marines space wolves
A beta sheet from a sucrose specific porin as surface
Free     Printables     Marius Mihasan

A beta sheet from a sucrose specific porin as surface

A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
—   Go to Printables  

similar models —

A beta sheet from a sucrose specific porin as surface alternatives
A betasheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
A betasheet from a sucrose specific porin as cartoon with the sidechains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
An alpha helix from Hemoglobin as surface
Marius Mihasan
An alpha helix from Hemoglobin as surface
BDNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
BDNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
A betasheet from a sucrose specific porin peptide backbone as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
Spirit Geolink bracket
NZ2000
Spirit Geolink bracket
The Holy Hand Grenade
popejpii
The Holy Hand Grenade
1949 Chevy Duplo
Woodmore
1949 Chevy Duplo
2025 — TROFP — Privacy Policy